PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010541718.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MIKC_MADS
Protein Properties Length: 215aa    MW: 24717.6 Da    PI: 9.2054
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010541718.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF80.41.2e-25959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien  nr vtf+kRr g++KKA+E+ vLCda+v++iif+s+gk+++++s
  XP_010541718.1  9 KRIENANNRLVTFTKRRSGMMKKAKEITVLCDAKVSLIIFASNGKMHDFCS 59
                    79***********************************************96 PP

2K-box75.91.1e-2571167197
           K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                     yq+  +++l++ak+esl++e++++kke+++Lq e+Rhl+Ged++sL++k L+ +e++++++l k+R++++e+l+++ ++ + +e+e+++   +L+
  XP_010541718.1  71 YQRIASTKLWDAKHESLSNEIDRIKKENDSLQMELRHLKGEDIQSLDIKSLMAIEHAVQNGLDKVRDHQMEFLMTKRRNGKIMEEENRQLSYQLQ 165
                     67777889**************************************************************************************9 PP

           K-box  96 kk 97 
                     ++
  XP_010541718.1 166 QQ 167
                     98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.216161IPR002100Transcription factor, MADS-box
CDDcd002653.51E-36280No hitNo description
SuperFamilySSF554552.09E-33296IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003197.0E-211057IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-263859IPR002100Transcription factor, MADS-box
PfamPF014866.4E-1682164IPR002487Transcription factor, K-box
PROSITE profilePS5129714.1184170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MGRGKIEIKR IENANNRLVT FTKRRSGMMK KAKEITVLCD AKVSLIIFAS NGKMHDFCSP  60
SMDLGDMLEQ YQRIASTKLW DAKHESLSNE IDRIKKENDS LQMELRHLKG EDIQSLDIKS  120
LMAIEHAVQN GLDKVRDHQM EFLMTKRRNG KIMEEENRQL SYQLQQQEIA IANNNARGMR  180
GNCGIHQEMA AGQFAFQVKP IQPNLQEKIM SLVID
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J4e-17289180Myocyte-specific enhancer factor 2A
3p57_I4e-17289180Myocyte-specific enhancer factor 2A
3p57_D4e-17289180Myocyte-specific enhancer factor 2A
3p57_C4e-17289180Myocyte-specific enhancer factor 2A
3p57_B4e-17289180Myocyte-specific enhancer factor 2A
3p57_A4e-17289180Myocyte-specific enhancer factor 2A
3kov_J4e-17289180Myocyte-specific enhancer factor 2A
3kov_I4e-17289180Myocyte-specific enhancer factor 2A
3kov_B4e-17289180Myocyte-specific enhancer factor 2A
3kov_A4e-17289180Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010541718.11e-159PREDICTED: floral homeotic protein PISTILLATA isoform X1
SwissprotP480071e-117PIST_ARATH; Floral homeotic protein PISTILLATA
TrEMBLA8V3451e-117A8V345_BRANA; PISTILLATA-1
STRINGAT5G20240.11e-114(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.11e-118MIKC_MADS family protein